| Primary information |
|---|
| ID | 11427 |
| Uniprot ID | P21819 |
| Description | Diuretic hormone 1 precursor (DH-1) (Diuretic peptide 1) (DP-1) (Mas-DH). |
| Organism | Manduca sexta |
| Txonomy | Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Sphingoidea;Sphingidae; Sphinginae; Manduca. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Regulation of fluid secretion |
| Length | 138 |
| Molecular Weight | 15297 |
| Name | Diuretic hormone 1 |
| Sequence | RMPSLSIDLPMSVLRQKLSLEKERKVHALRAAANRNFLNDI |
| Sequence map | 41 (81-121) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P35464 |
| Domain | NA |
| Pharmaceutical Use | NA
|