| Primary information |
|---|
| ID | 11426 |
| Uniprot ID | P21702 |
| Description | Prolactin-3D1 precursor (Chorionic somatomammotropin hormone 1)(Placental lactogen I) (PL-I). |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | Placental lactogen I is expressed in mid- pregnancy; while placental lactogen II is expressed throughout the later half of pregnancy. |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 230 |
| Molecular Weight | 26324 |
| Name | Prolactin-3D1 |
| Sequence | SKPTAIVSTDDLYHCLVEQSHNTFIMAADVYREFDINFAKRSWMKDRILPLCHTASIHTPENLEEVHEMKTEDFLNSIINVSVSWKEPLKHLVVCSDCSSGASVSMGKKAVDMKDKNLIILEGLQTLYNRTQAKVEENFENFDYPAWSGLKDLDSSDEEHHLFAICNLCRCVKRDIHKIDTYLKVLRCRVVFKNECGVSTF |
| Sequence map | 201 (30-230) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P05710 |
| Domain | NA |
| Pharmaceutical Use | NA
|