| Primary information |
|---|
| ID | 11413 |
| Uniprot ID | P17572 |
| Description | Prolactin precursor (PRL). |
| Organism | Meleagris gallopavo |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Meleagris. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | NA |
| Post Translational Modification | Three forms are found; non-glycosylated; glycosylated and one form seems to be only O-glycosylated. |
| Function | NA |
| Length | 229 |
| Molecular Weight | 25854 |
| Name | Prolactin |
| Sequence | LPICSSGSVNCQVSLGELFDRAVRLSHYIHFLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQTQQIHHEELLNLILGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRIHSGDAGNEVFSQWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDNNC |
| Sequence map | 199 (31-229) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q91094 |
| Domain | NA |
| Pharmaceutical Use | NA
|