| Primary information |
|---|
| ID | 11397 |
| Uniprot ID | P09916 |
| Description | Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH). |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
| Length | 104 |
| Molecular Weight | 12266 |
| Name | Somatoliberin |
| Sequence | HADAIFTSSYRRILGQLYARKLLHEIMNRQQGERNQEQRSRFN |
| Sequence map | 43 (31-73) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q02644 |
| Domain | NA |
| Pharmaceutical Use | NA
|