| Primary information |
|---|
| ID | 11377 |
| Uniprot ID | P06850 |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Length | 196 |
| Molecular Weight | 21422 |
| Name | Corticoliberin |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Sequence map | 41 (154-194) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P34998; Q13324;P34998;Q13324 |
| Domain | NA |
| Pharmaceutical Use | NA
|