| Primary information |
|---|
| ID | 11374 |
| Uniprot ID | P06307 |
| Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | NA |
| Post Translational Modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas; binding to CCK-B receptors stimulates gastric acid secretion |
| Length | 115 |
| Molecular Weight | 12669 |
| Name | Cholecystokinin-39 |
| Sequence | YIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDF |
| Sequence map | 39 (65-103) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P32238; P32239; P32238; P32239; P32238; P32238;P32239;P32238 |
| Domain | NA |
| Pharmaceutical Use | NA
|