Primary information |
---|
ID | 11372 |
Uniprot ID | P06307 |
Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | NA |
Post Translational Modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas; binding to CCK-B receptors stimulates gastric acid secretion |
Length | 115 |
Molecular Weight | 12669 |
Name | Cholecystokinin |
Sequence | QPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS |
Sequence map | 95 (21-115) |
PDB ID | NA |
Drugpedia | NA |
Receptor | P32238; P32239; P32238; P32239; P32238; P32238;P32239;P32238 |
Domain | NA |
Pharmaceutical Use | NA
|