| Primary information |
|---|
| ID | 11369 |
| Uniprot ID | P04808 |
| Description | Prorelaxin H1 precursor [Cleaved into- - Relaxin B chain; Relaxin A chain]. |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Prostate. Not expressed in placenta; decidua or ovary |
| Post Translational Modification | NA |
| Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals. May be involved in remodeling of connective tissues during pregnancy; promoting growth of pubic ligaments and ripening of the cervix |
| Length | 185 |
| Molecular Weight | 21146 |
| Name | Relaxin B chain |
| Sequence | VAAKWKDDVIKLCGRELVRAQIAICGMSTWS |
| Sequence map | 31 (23-53) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9HBX9;Q8WXD0 |
| Domain | NA |
| Pharmaceutical Use | NA
|