| Primary information |
|---|
| ID | 11361 |
| Uniprot ID | P04089 |
| Description | Parathyroid hormone precursor (Parathyrin) (PTH). |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | Hypothalamus and parathyroid gland |
| Post Translational Modification | NA |
| Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
| Length | 115 |
| Molecular Weight | 12722 |
| Name | Parathyroid hormone (Parathyrin) (PTH) |
| Sequence | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFVSLGVQMAAREGSYQRPTKKEENVLVDGNSKSLGEGDKADVDVLVKAKSQ |
| Sequence map | 84 (32-115) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P25961 |
| Domain | NA |
| Pharmaceutical Use | NA
|