| Primary information |
|---|
| ID | 11355 |
| Uniprot ID | P01355 |
| Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 39(CCK39); Cholecystokinin 33 (CCK33); Cholecystokinin 22 (CCK22);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | The shortest form (CCK8) is predominantly found in the brain; whereas the larger ones are found in the intestine |
| Post Translational Modification | Cholecystokinin; also known as CCK58; is proteolytically cleaved to produce a number of active cholecystokinins. Sulfation of Tyr-97 is essential for receptor activation. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas; binding to CCK-B receptors stimulates gastric acid secretion |
| Length | 115 |
| Molecular Weight | 12841 |
| Name | Cholecystokinin-39 |
| Sequence | YIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF |
| Sequence map | 39 (65-103) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P30553;P30551 |
| Domain | NA |
| Pharmaceutical Use | NA
|