Primary information |
---|
ID | 11354 |
Uniprot ID | P01355 |
Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 39(CCK39); Cholecystokinin 33 (CCK33); Cholecystokinin 22 (CCK22);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | The shortest form (CCK8) is predominantly found in the brain; whereas the larger ones are found in the intestine |
Post Translational Modification | Cholecystokinin; also known as CCK58; is proteolytically cleaved to produce a number of active cholecystokinins. Sulfation of Tyr-97 is essential for receptor activation. |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas; binding to CCK-B receptors stimulates gastric acid secretion |
Length | 115 |
Molecular Weight | 12841 |
Name | Cholecystokinin |
Sequence | AVLRPDSEPRARLGALLARYIQQVRKAPSGRMSVLKNLQGLDPSHRISDRDYMGWMDF |
Sequence map | 58 (46-103) |
PDB ID | NA |
Drugpedia | NA |
Receptor | P30553;P30551 |
Domain | NA |
Pharmaceutical Use | NA
|