| Primary information |
|---|
| ID | 11345 |
| Uniprot ID | P01350 |
| Description | Gastrin precursor [Cleaved into- - Gastrin-71 (Component I); Gastrin-52(G52); Big gastrin (Gastrin-34) (G34) (Component II); Gastrin(Gastrin-17) (G17) (Component III); Gastrin-14 (G14); Gastrin-6 (G6)]. |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | NA |
| Post Translational Modification | Two different processing pathways probably exist in antral G- cells. In the dominant pathway progastrin is cleaved at three sites resulting in two major bioactive gastrins; gastrin-34 and gastrin-17. |
| Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
| Length | 101 |
| Molecular Weight | 11394 |
| Name | Gastrin-52 |
| Sequence | DLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF |
| Sequence map | 52 (41-92) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P32238; P32239; P32239; P32239;P32239 |
| Domain | NA |
| Pharmaceutical Use | NA
|