| Primary information |
|---|
| ID | 11340 |
| Uniprot ID | P01323 |
| Description | Insulin-2 precursor [Cleaved into- - Insulin-2 B chain; Insulin-2 A chain]. |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides; amino acids and fatty acids. It accelerates glycolysis; the pentose phosphate cycle; and glycogen synthesis in liver |
| Length | 110 |
| Molecular Weight | 12339 |
| Name | Insulin-2 B chain |
| Sequence | FVKQHLCGSHLVEALYLVCGERGFFYTPMS |
| Sequence map | 30 (25-54) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P15127 |
| Domain | NA |
| Pharmaceutical Use | NA
|