| Primary information |
|---|
| ID | 11336 |
| Uniprot ID | P01308 |
| Description | Insulin precursor [Cleaved into- - Insulin B chain; Insulin A chain]. |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides; amino acids and fatty acids. It accelerates glycolysis; the pentose phosphate cycle; and glycogen synthesis in liver |
| Length | 110 |
| Molecular Weight | 11981 |
| Name | Insulin B chain |
| Sequence | FVNQHLCGSHLVEALYLVCGERGFFYTPKT |
| Sequence map | 30 (25-54) |
| PDB ID | 1A7F1AI01AIY1B9E1BEN1EFE1EV31EV61EVR1FU21FUB1G7A1G7B1GUJ1HIQ1HIS1HIT1HLS1HTV1HUI1IOG1IOH1J731JCA1JCO |
| Drugpedia | NA |
| Receptor | P08069; P06213; P06213;P06213 |
| Domain | NA |
| Pharmaceutical Use | Available under the names Humulin or Humalog (Eli Lilly) and Novolin (Novo Nordisk). Used in the treatment of diabetes. Humalog is an insulin analog with 52-Lys-Pro-53 instead of 52-Pro-Lys-53.
|