| Primary information |
|---|
| ID | 11335 |
| Uniprot ID | P01287 |
| Description | Somatoliberin (Growth hormone-releasing factor) (GRF) (Growth hormone-releasing hormone) (GHRH). |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone |
| Length | 44 |
| Molecular Weight | 5110 |
| Name | Growth hormone-releasing factor (GRF) (Growth hormone-releasing hormone) (GHRH) |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL |
| Sequence map | 44 (1-44) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P34999 |
| Domain | NA |
| Pharmaceutical Use | NA
|