| Primary information |
|---|
| ID | 11330 |
| Uniprot ID | P01275 |
| Description | Glucagon precursor [Cleaved into- - Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1; GLP-2; oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 |
| Post Translational Modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells; the major bioactive hormone is glucagon cleaved by PCSK2/ |
| Function | Oxyntomodulin significantly reduces food intake. Inhibits gastric emptying in humans. Suppression of gastric emptying may lead to increased gastric distension; which may contribute to satiety by causing a sensation of fullness |
| Length | 180 |
| Molecular Weight | 20909 |
| Name | Oxyntomodulin |
| Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
| Sequence map | 37 (53-89) |
| PDB ID | 1BH01D0R1NAU |
| Drugpedia | NA |
| Receptor | P43220; O95838; P43220; P47871;P47871 |
| Domain | NA |
| Pharmaceutical Use | Available under the names Glucagon (Eli Lilly) and GlucaGen or Glucagon Novo Nordisk (Novo Nordisk). Used to treat severe hypoglycemia in insulin-dependent diabetics.
|