| Primary information |
|---|
| ID | 11328 |
| Uniprot ID | P01270 |
| Description | Parathyroid hormone precursor (Parathyrin) (PTH) (Parathormone). |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion |
| Length | 115 |
| Molecular Weight | 12861 |
| Name | Parathyroid hormone (Parathyrin) (PTH) |
| Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
| Sequence map | 84 (32-115) |
| PDB ID | 1BWX1ET11ET21FVY1HPH1HPY1HTH1ZWA1ZWB1ZWD1ZWE1ZWF1ZWG |
| Drugpedia | NA |
| Receptor | Q03431; P49190;Q03431 |
| Domain | NA |
| Pharmaceutical Use | NA
|