| Primary information |
|---|
| ID | 11308 |
| Uniprot ID | P01225 |
| Description | Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain). |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Stimulates development of follicle and spermatogenesis in the reproductive organs |
| Length | 129 |
| Molecular Weight | 14700 |
| Name | Follicle-stimulating hormone beta subunit |
| Sequence | NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
| Sequence map | 111 (19-129) |
| PDB ID | 1FL71XWD |
| Drugpedia | NA |
| Receptor | P23945;P23945 |
| Domain | NA |
| Pharmaceutical Use | Available under the names Gonal-F or Metrodin HP (Serono) and Puregon (Organon). Used in the treatment of infertility in women with proven hypopituitarism or who have not responded to clomifene; or in |