Primary information |
---|
ID | 11295 |
Uniprot ID | P01201 |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Cleaved into- - NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotr |
Organism | Macaca nemestrina |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
Subcellular Location | NA |
Developmental Stage | NA |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
Length | 264 |
Molecular Weight | 29172 |
Name | Lipotropin gamma (Gamma-LPH) |
Sequence | ELTGQRPRAGDGPDGPADDGAGPRADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKD |
Sequence map | 56 (176-231) |
PDB ID | NA |
Drugpedia | NA |
Receptor | Q864J8 |
Domain | NA |
Pharmaceutical Use | NA
|