| Primary information |
|---|
| ID | 11292 |
| Uniprot ID | P01201 |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Cleaved into- - NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotr |
| Organism | Macaca nemestrina |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;Catarrhini; Cercopithecidae; Cercopithecinae; Macaca. |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | ACTH stimulates the adrenal glands to release cortisol |
| Length | 264 |
| Molecular Weight | 29172 |
| Name | Corticotropin |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Sequence map | 39 (135-173) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q864J8 |
| Domain | NA |
| Pharmaceutical Use | NA
|