Primary information |
---|
ID | 11277 |
Uniprot ID | P01192 |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Cleaved into- - NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma- |
Organism | Sus scrofa |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
Subcellular Location | NA |
Developmental Stage | NA |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis. |
Length | 267 |
Molecular Weight | 28895 |
Name | Lipotropin beta (Beta-LPH) |
Sequence | ELAGAPPEPARDPEAPAEGAAARAELEYGLVAEAEAAEKKDEGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIVKNAHKKGQ |
Sequence map | 91 (177-267) |
PDB ID | NA |
Drugpedia | NA |
Receptor | Q9TU05 |
Domain | NA |
Pharmaceutical Use | NA
|