| Primary information |
|---|
| ID | 11275 |
| Uniprot ID | P01192 |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Cleaved into- - NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma- |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | ACTH stimulates the adrenal glands to release cortisol |
| Length | 267 |
| Molecular Weight | 28895 |
| Name | Corticotropin |
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDELAEAFPLEF |
| Sequence map | 39 (136-174) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9TU05 |
| Domain | NA |
| Pharmaceutical Use | NA
|