| Primary information |
|---|
| ID | 11272 |
| Uniprot ID | P01191 |
| Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Cleaved into- - NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma- |
| Organism | Ovis aries |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
| Subcellular Location | NA |
| Developmental Stage | NA |
| Similarity | Belongs to the POMC family. |
| Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
| Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
| Function | Beta-endorphin is an endogenous opiate |
| Length | 212 |
| Molecular Weight | 23464 |
| Name | Beta-endorphin |
| Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ |
| Sequence map | 31 (182-212) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q9TU77;O19037 |
| Domain | NA |
| Pharmaceutical Use | NA
|