Primary information |
---|
ID | 11267 |
Uniprot ID | P01191 |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Cleaved into- - NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma- |
Organism | Ovis aries |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
Subcellular Location | NA |
Developmental Stage | NA |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. |
Function | ACTH stimulates the adrenal glands to release cortisol |
Length | 212 |
Molecular Weight | 23464 |
Name | Corticotropin |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAQAFPLEF |
Sequence map | 39 (81-119) |
PDB ID | NA |
Drugpedia | NA |
Receptor | Q9TU77;O19037 |
Domain | NA |
Pharmaceutical Use | NA
|