Primary information |
---|
ID | 11251 |
Uniprot ID | P01189 |
Description | Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Cleaved into- - NPP; Melanotropin gamma (Gamma-MSH); Potential peptide;Corticotropin (Adrenocorticotropic hormone) (ACTH); Melanotropin alpha(Alpha-MSH); Corticotropin-like intermediary peptide (CLIP);Lipotropin beta (Beta-LPH); Lipotr |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | NA |
Developmental Stage | NA |
Similarity | Belongs to the POMC family. |
Tissue Specificity | ACTH and MSH are produced by the pituitary gland |
Post Translational Modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. O-glycosylated; reducing sugar is probably N- acetylgalactosamine. |
Function | ACTH stimulates the adrenal glands to release cortisol |
Length | 267 |
Molecular Weight | 29424 |
Name | Corticotropin |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
Sequence map | 39 (138-176) |
PDB ID | NA |
Drugpedia | NA |
Receptor | Q01718; Q01726; P41968; P32245; P04201; P35372; Q01726; P41968; P32245; P33032; Q01726; P41968; P322 |
Domain | NA |
Pharmaceutical Use | NA
|