| Primary information |
|---|
| ID | 11225 |
| Uniprot ID | P11953 |
| Description | Relaxin [Cleaved into- - Relaxin B chain; Relaxin A chain]. |
| Organism | Squalus acanthias |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Squaliformes; Squaloidei;Squalidae; Squalus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | The function of relaxin in an oviparous species is not yet known |
| Length | 54 |
| Molecular Weight | 5910 |
| Name | Relaxin B chain |
| Sequence | QSFKNAEPGIKLCGREFIRAVIYTCGGSRW |
| Sequence map | 30 (1-30) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|