| Primary information |
|---|
| ID | 11223 |
| Uniprot ID | P11952 |
| Description | Relaxin [Cleaved into- - Relaxin B chain; Relaxin A chain]. |
| Organism | Raja erinacea |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Squalea; Hypnosqualea; Pristiorajea; Batoidea;Rajiformes; Rajidae; Leucoraja. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 64 |
| Molecular Weight | 7499 |
| Name | Relaxin B chain |
| Sequence | RPNWEERSRLCGRDLIRAFIYLCGGTRWTRLPNFGNYPIM |
| Sequence map | 40 (1-40) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|