| Primary information |
|---|
| ID | 11210 |
| Uniprot ID | P01347 |
| Description | Prorelaxin 1 precursor [Cleaved into- - Relaxin B chain; Relaxin A chain]. |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Relaxin is an ovarian hormone that acts with estrogen to produce dilatation of the birth canal in many mammals |
| Length | 186 |
| Molecular Weight | 20489 |
| Name | Relaxin B chain |
| Sequence | RVSEEWMDQVIQVCGRGYARAWIEVCGASVGRLAL |
| Sequence map | 35 (23-57) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|