| Primary information |
|---|
| ID | 11197 |
| Uniprot ID | P09681 |
| Description | Gastric inhibitory polypeptide precursor (GIP) (Glucose-dependentinsulinotropic polypeptide). |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion |
| Length | 153 |
| Molecular Weight | 17108 |
| Name | Gastric inhibitory polypeptide |
| Sequence | YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Sequence map | 42 (52-93) |
| PDB ID | 1T5Q2B4N |
| Drugpedia | NA |
| Receptor | P48546 |
| Domain | NA |
| Pharmaceutical Use | NA
|