Primary information |
---|
ID | 11194 |
Uniprot ID | Q9PU29 |
Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 70(CCK70); Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)]. |
Organism | Struthio camelus |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine |
Post Translational Modification | The precursor is cleaved by enzymes to produce a number of active cholecystokinins. |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear |
Length | 130 |
Molecular Weight | 14273 |
Name | Cholecystokinin |
Sequence | QQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS |
Sequence map | 110 (21-130) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|