| Primary information |
|---|
| ID | 11194 |
| Uniprot ID | Q9PU29 |
| Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 70(CCK70); Cholecystokinin 8 (CCK8); Cholecystokinin 7 (CCK7)]. |
| Organism | Struthio camelus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Palaeognathae; Struthioniformes; Struthionidae; Struthio. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | Highly concentrated in the duodenum. Also localized in more distal parts of the small intestine |
| Post Translational Modification | The precursor is cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear |
| Length | 130 |
| Molecular Weight | 14273 |
| Name | Cholecystokinin |
| Sequence | QQTAGSHNGNPLAAELEQSLTEHHRHVRAPSSAGPLKPVPRLDGSIDQRANIGALLAKYLQQARKGPTGRISVMGNRVQSIDPTHRINDRDYMGWMDFGRRSAEEYEYSS |
| Sequence map | 110 (21-130) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|