| Primary information |
|---|
| ID | 11183 |
| Uniprot ID | P01356 |
| Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | Synthesized in both cerebral cortex and duodenal mucosa |
| Post Translational Modification | The precursor is cleaved by enzymes to produce a number of active cholecystokinins. Brain contains CCK-octapeptide (CCK8) and several CCK-desoctapeptides; whereas pig gut contains intact CCK33; CCK39; |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas; binding to CCK-B receptors stimulates gastric acid secretion. |
| Length | 114 |
| Molecular Weight | 12526 |
| Name | Cholecystokinin |
| Sequence | QPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGALLARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS |
| Sequence map | 94 (21-114) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|