Primary information |
---|
ID | 11166 |
Uniprot ID | O93464 |
Description | Cholecystokinins precursor (CCK8) [Cleaved into- - Cholecystokinin 8 (CCK8);Cholecystokinin 12 (CCK12); Cholecystokinin 26 (CCK26);Cholecystokinin 36 (CCK36); Cholecystokinin 69 (CCK69)]. |
Organism | Carassius auratus |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
Subcellular Location | Secreted (Potential) |
Developmental Stage | Expression in the brain shows variation throughout the seasonal sexual cycle; in the optic tectum-thalamus of females; expression levels are lower in early gonadal recrudescence (October) compared to |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | Expressed in the ovary; kidney; gill; gastrointestinal tract and pituitary. Differentially expressed in the brain in the optic tectum-thalamus; hypothalamus; telencephalon; olfactory bulb and tract; p |
Post Translational Modification | The precursor is cleaved by enzymes to produce a number of active cholecystokinins. |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Induces the secretion of gonadotropin and growth hormone from the pituitary. Suppresses food intake and decreases the expression of preprosomatostatin genes in the forebrain |
Length | 123 |
Molecular Weight | 13439 |
Name | Cholecystokinin 36 |
Sequence | IISTKGTYRRSPSPKSKSMGNNHRIKDRDYLGWMDF |
Sequence map | 36 (76-111) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|