| Primary information |
|---|
| ID | 11154 |
| Uniprot ID | O02686 |
| Description | Gastrin precursor [Cleaved into- - Big gastrin (Gastrin 34) (G34); Gastrin]. |
| Organism | Ovis aries |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Caprinae; Ovis. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine |
| Length | 104 |
| Molecular Weight | 11532 |
| Name | Big gastrin |
| Sequence | QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWM |
| Sequence map | 34 (59-92) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|