| Primary information |
|---|
| ID | 11124 |
| Uniprot ID | P09687 |
| Description | Glucagon precursor [Cleaved into- - Glucagon-29; Glucagon-33; Glucagon-likepeptide] (Fragments). |
| Organism | Scyliorhinus canicula |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Chondrichthyes;Elasmobranchii; Galeomorphii; Galeoidea; Carcharhiniformes;Scyliorhinidae; Scyliorhinus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Promotes hydrolysis of glycogen and lipids; and raises the blood sugar level |
| Length | 62 |
| Molecular Weight | 7270 |
| Name | Glucagon-33 |
| Sequence | HSEGTFTSDYSKYMDNRRAKDFVQWLMSTKRNG |
| Sequence map | 33 (1-33) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|