| Primary information |
|---|
| ID | 11119 |
| Uniprot ID | P15438 |
| Description | Glucagon precursor [Cleaved into- - Glucagon; Glucagon-36 (Oxyntomodulin);Glucagon-like peptide 1; Glucagon-like peptide 2] (Fragments). |
| Organism | Rana catesbeiana |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Neobatrachia; Ranoidea; Ranidae; Rana;Aquarana. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Promotes hydrolysis of glycogen and lipids; and raises the blood sugar level |
| Length | 103 |
| Molecular Weight | 11721 |
| Name | Glucagon-36 |
| Sequence | HSQGTFTSDYSKYLDSRRAQDFVQWLMNSKRSGGIS |
| Sequence map | 36 (1-36) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|