| Primary information |
|---|
| ID | 11096 |
| Uniprot ID | O12956 |
| Description | Glucagon precursor [Cleaved into- - Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide 1 (GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));Glucagon-like peptide 2 (GLP-2)]. |
| Organism | Heloderma suspectum |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Lepidosauria; Squamata; Scleroglossa; Anguimorpha; Helodermatidae;Heloderma. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Isoform LPII is expressed in both pancreas and intestine. Expression of isoform LPI is restricted to the pancreas. Neither isoform is detected in salivary glands |
| Post Translational Modification | NA |
| Function | GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels |
| Length | 204 |
| Molecular Weight | 23553 |
| Name | Glucagon-like peptide 1 |
| Sequence | HAEYERHADGRYTSDISSYLEGQAAKEFIAWLVNGRG |
| Sequence map | 37 (110-146) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|