Primary information |
---|
ID | 11094 |
Uniprot ID | P68259 |
Description | Glucagon precursor [Cleaved into- - Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide 1 (GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));Glucagon-like peptide 2 (GLP-2)]. |
Organism | Gallus gallus |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | NA |
Post Translational Modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells; the major bioactive hormone is glucagon cleaved by PCSK2/ |
Function | GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine; concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis |
Length | 206 |
Molecular Weight | 23876 |
Name | Glucagon-like peptide 2 |
Sequence | HADGTFTSDINKILDDMAAKEFLKWLINTKVTQ |
Sequence map | 33 (166-198) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|