| Primary information |
|---|
| ID | 11093 |
| Uniprot ID | P68259 |
| Description | Glucagon precursor [Cleaved into- - Glicentin-related polypeptide (GRPP);Glucagon; Glucagon-like peptide 1 (GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-like peptide 1(7-36) (GLP-1(7-36));Glucagon-like peptide 2 (GLP-2)]. |
| Organism | Gallus gallus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells; the major bioactive hormone is glucagon cleaved by PCSK2/ |
| Function | GLP-1 is a potent stimulator of glucose-dependent insulin release |
| Length | 206 |
| Molecular Weight | 23876 |
| Name | Glucagon-like peptide 1 |
| Sequence | HSEFERHAEGTYTSDITSYLEGQAAKEFIAWLVNGRG |
| Sequence map | 37 (112-148) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|