Primary information |
---|
ID | 11090 |
Uniprot ID | P05110 |
Description | Glucagon precursor [Cleaved into- - Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
Organism | Cavia porcellus |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia;Hystricognathi; Caviidae; Cavia. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | NA |
Post Translational Modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells; the major bioactive hormone is glucagon cleaved by PCSK2/ |
Function | GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues; independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH; TSH; CRH; oxytocin; and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferaton |
Length | 180 |
Molecular Weight | 20972 |
Name | Glucagon-like peptide 1 |
Sequence | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Sequence map | 37 (92-128) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|