| Primary information |
|---|
| ID | 11084 |
| Uniprot ID | P29794 |
| Description | Glucagon precursor [Cleaved into- - Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
| Organism | Canis familiaris |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1; GLP-2; oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 |
| Post Translational Modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells; the major bioactive hormone is glucagon cleaved by PCSK2/ |
| Function | Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity |
| Length | 180 |
| Molecular Weight | 21115 |
| Name | Glicentin |
| Sequence | RSLQDTEEKSRSFSAPQTEPLNDLDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| Sequence map | 69 (21-89) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|