| Primary information |
|---|
| ID | 11070 |
| Uniprot ID | P01278 |
| Description | Glucagon-1 precursor (Glucagon I) [Cleaved into- - Glicentin-relatedpolypeptide (GRPP); Glucagon-1 (Glucagon I); Glucagon-like peptide 1(Glucagon-like peptide I)]. |
| Organism | Lophius americanus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Paracanthopterygii; Lophiiformes; Lophiidae; Lophius. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 124 |
| Molecular Weight | 14165 |
| Name | Glucagon-like peptide 1 |
| Sequence | HADGTFTSDVSSYLKDQAIKDFVDRLKAGQVRRE |
| Sequence map | 34 (91-124) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|