| Primary information |
|---|
| ID | 11068 |
| Uniprot ID | Q9DFJ9 |
| Description | Thymosin beta. |
| Organism | Gillichthys mirabilis |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Gobioidei;Gobiidae; Gillichthys. |
| Subcellular Location | Cytoplasm |
| Developmental Stage | NA |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Length | 44 |
| Molecular Weight | 4914 |
| Name | Thymosin beta |
| Sequence | SDKPDVKEVESFDKTTLKKTTTNEKNTLPTKEVIEQEKSGGSD |
| Sequence map | 43 (2-44) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|