| Primary information |
|---|
| ID | 11067 |
| Uniprot ID | Q9DET5 |
| Description | Thymosin beta. |
| Organism | Coturnix coturnix japonica |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Coturnix. |
| Subcellular Location | Cytoplasm |
| Developmental Stage | NA |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Length | 45 |
| Molecular Weight | 5245 |
| Name | Thymosin beta |
| Sequence | CDKPDLSEVEKFDKKKLKKTNTEEKNTLPSKETIEQEKECVKSS |
| Sequence map | 44 (2-45) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|