| Primary information |
|---|
| ID | 11066 |
| Uniprot ID | P18758 |
| Description | Thymosin beta-4 (T beta 4) (Thymosin beta 4Xen). |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
| Subcellular Location | Cytoplasm |
| Developmental Stage | NA |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | Spleen; kidney; heart; and oocytes |
| Post Translational Modification | NA |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Length | 44 |
| Molecular Weight | 5097 |
| Name | Thymosin beta-4 |
| Sequence | SDKPDMAEIEKFDKAKLKKTETQEKNPLPSKETIEQEKQTSES |
| Sequence map | 43 (2-44) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|