| Primary information |
|---|
| ID | 11061 |
| Uniprot ID | P20065 |
| Description | Thymosin beta-4 (T beta 4) [Cleaved into- - Hematopoietic system regulatorypeptide (Seraspenide)]. |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular Location | Cytoplasm |
| Developmental Stage | NA |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | Originally found in thymus but it is widely distributed in many tissues |
| Post Translational Modification | NA |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Length | 50 |
| Molecular Weight | 5679 |
| Name | Thymosin beta-4 |
| Sequence | MLLPATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Sequence map | 50 (1-50) |
| PDB ID | 1T44 |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|