| Primary information |
|---|
| ID | 11055 |
| Uniprot ID | P62326 |
| Description | Thymosin beta-4 (T beta 4) [Cleaved into- - Hematopoietic system regulatorypeptide (Seraspenide)]. |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular Location | Cytoplasm |
| Developmental Stage | NA |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Length | 44 |
| Molecular Weight | 5053 |
| Name | Thymosin beta-4 |
| Sequence | SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
| Sequence map | 43 (2-44) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|