| Primary information |
|---|
| ID | 11050 |
| Uniprot ID | P63312 |
| Description | Thymosin beta-10. |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Rattus. |
| Subcellular Location | Cytoplasm |
| Developmental Stage | Found to decrease dramatically after birth. |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Length | 44 |
| Molecular Weight | 5026 |
| Name | Thymosin beta-10 |
| Sequence | ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS |
| Sequence map | 43 (2-44) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|