| Primary information |
|---|
| ID | 11049 |
| Uniprot ID | P21753 |
| Description | Thymosin beta-10 (Thymosin beta-9). |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Suina; Suidae;Sus. |
| Subcellular Location | Cytoplasm |
| Developmental Stage | NA |
| Similarity | Belongs to the thymosin beta family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
| Length | 42 |
| Molecular Weight | 4823 |
| Name | Thymosin beta-10 |
| Sequence | ADKPDMGEINSFDKAKLKKTETQEKNTLPTKETIEQEKQAK |
| Sequence map | 41 (2-42) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|