Primary information |
---|
ID | 11048 |
Uniprot ID | P63313 |
Description | Thymosin beta-10. |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Cytoplasm |
Developmental Stage | Found to decrease dramatically after birth. |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Length | 44 |
Molecular Weight | 5026 |
Name | Thymosin beta-10 |
Sequence | ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS |
Sequence map | 43 (2-44) |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|