| Primary information |
|---|
| ID | 11034 |
| Uniprot ID | P41547 |
| Description | Calcitonin precursor. |
| Organism | Canis familiaris |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Canidae;Canis. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | Synthesized by C-cells of the thyroid gland |
| Post Translational Modification | NA |
| Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Length | 130 |
| Molecular Weight | 14051 |
| Name | Calcitonin |
| Sequence | CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP |
| Sequence map | 32 (85-116) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|